SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010409 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010409
Domain Number 1 Region: 174-350
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-48
Family DBL homology domain (DH-domain) 0.00054
Further Details:      
 
Domain Number 2 Region: 627-723
Classification Level Classification E-value
Superfamily PH domain-like 7.4e-21
Family Pleckstrin-homology domain (PH domain) 0.00087
Further Details:      
 
Domain Number 3 Region: 398-476
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000189
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 4 Region: 543-601
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000528
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010409   Gene: ENSMEUG00000011398   Transcript: ENSMEUT00000011443
Sequence length 754
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1839:525:9877:-1 gene:ENSMEUG00000011398 transcript:ENSMEUT00000011443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPKPAHLLGTRLAPLLEPIPPAPSRPLPADPRLTRASQPRAEAGGGTSAVSSLIERFERE
PAILVPSELPTLRLREGSPCLLLSAPGEKVPNRDSGIGSISSPSTNEETCLANAGNSGRH
SCPRTSPTPVAPLQPSQSPMEADSDLDEEEEEDEEEGERGCPPRMERQDSSELTVQQKVF
HIANELLQTEKAYVSRLHLLDQVFCARLLEEARTRSSFPADVVHGIFSNICSIYCFHQQF
LLPELEKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNFDRAVELVNTWTERSAPFKVII
HEVQKEEACGNLTLQHHMLEPVQRIPRYELLLKDYLLKLPHGSPDSKDAEXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGHILKLSAKNGTTQDRYLILF
NDRLLYCVPKLRLLGQKFSVRACIDVDGLELKESSNLNLPRTFLVSGKQRSLELQAXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXCQDPFNPITKRRHHCKCGHVVCGKCSEFRARLVYDNNRSNRVCLDCYTALRGAQGPS
PSAGQNTPQRRRSILEKQASVAAENSLVCSFMYYMEKGAKGWHKAWFVVPESEPLVLYIY
GAPQDVKAQRSLPLIGFEVGAPEANEHKERRHVFKITQSHLAWYFSPETEELQKRWMDVL
ARAGRGDELQAGSSILESREQDENAAAAAAPQQW
Download sequence
Identical sequences ENSMEUP00000010409 ENSMEUP00000010409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]