SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010617 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010617
Domain Number 1 Region: 69-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-21
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 5-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000337
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010617   Gene: ENSMEUG00000011655   Transcript: ENSMEUT00000011680
Sequence length 134
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_10091:28463:42692:-1 gene:ENSMEUG00000011655 transcript:ENSMEUT00000011680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSHTCGNPGEILKGVLHGARFNIGDKIRYSCLSGYVLEGHAMLTCIVSPGNGALWDFPA
PFCRAEGACGGTLRGTSGAIFSPHFPSEYDNNADCTWTILAEPGDTIALVFTDFQLEEGY
DFLEISGTEAPSIW
Download sequence
Identical sequences ENSMEUP00000010617 ENSMEUP00000010617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]