SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010697 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010697
Domain Number 1 Region: 576-669
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.27e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.00082
Further Details:      
 
Domain Number 2 Region: 681-772
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.82e-17
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 13-124
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000211
Family G proteins 0.0011
Further Details:      
 
Domain Number 4 Region: 292-338,498-542
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000305
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010697   Gene: ENSMEUG00000011729   Transcript: ENSMEUT00000011772
Sequence length 802
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6436:15638:152499:1 gene:ENSMEUG00000011729 transcript:ENSMEUT00000011772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXFAMWVDAVVFVFSLEDEISFQTVYHYYSRMANYRNTSEIPMVL
VGTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQKIVATRKK
QQLSIGPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRI
DVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKSLESRADSIGSGRAIPIKQGMLLK
RSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXNVTASASVSQMASGISLVSFNTRPDGMHQRSYS
VSSADQWSEATVIANSGISSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXQEENLEFIIVSLTGQTWHFEAAAYEERDAWVQAIESQILASLQSC
SSKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNWASLNLGALMCIECSGIHRNLG
THLSRVRSLDLDDWPIELIKVMSSIGNELANSVWEESCQGHMKPSLDSTREEKERWIRAK
YEQKLFLAPLPCMDLSLGQHLLRATADEDLRTVILLLAHGSREEVNETCGESDGRTALHL
ACRKGNVVLVQLLIWYGVDVMARDAHGNTALAYARQAPSQECIDILLQYGCPDERFVLMA
TPNLSRKNNNRNHSSGRMPTIL
Download sequence
Identical sequences ENSMEUP00000010697 ENSMEUP00000010697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]