SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010933 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010933
Domain Number 1 Region: 433-512,714-818
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-21
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000010933
Domain Number - Region: 99-120,195-316,343-366
Classification Level Classification E-value
Superfamily ARM repeat 0.00345
Family HEAT repeat 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010933   Gene: ENSMEUG00000011998   Transcript: ENSMEUT00000012035
Sequence length 834
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_6926:13966:139940:-1 gene:ENSMEUG00000011998 transcript:ENSMEUT00000012035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHLFRLVLGQKDLSRAGDLFSLNDSEIEESLSEALEQIKIISSSSDYSSNGNDQAVVEI
CITRITTAIRETESIEKHGKALVALWESCLEHNLRPSGKDEDTPHAKIASDITSCILQNY
NRPPVMALAVPVAVKFLQTGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSM
LLRVLPSVYEKQPQPINSHVMELVTLMCDLETTEQHHLLRLLQIVARRKRPTVLQECIPF
LIGHLKNPTHSDIILNILIEISSYEPAALSHFLPTLKEIGTSFPSLIGRMARIYGAVGHV
NEESARTCLTYLVDQLANMEHSFHHLLLLEIKNLTDTFSTILGTQSRDIYRMSNSFTAIA
KLLIRHLDSNNTQRRRTESEPEKEPSEPLQDLKSAATNGNEEDERLQVKIQAFEEKINGE
NSPPGSVRRYSLSQVSKEERKDMRFNRSKSLALHAVHLNHTNSDDAQDVKNEDVMASISF
SEIDPLSQENYKSPFKADTEESQLEISSISHPRSKWTESENLPETVKENDPEETPETTQS
HVEYQDKLYLYLKENLSKVKAYVMEIGRSIPVPDQCTIEDAAGSCVAKLSFSCTLKGHYC
LYSKSSFTLISHQPQLWIHIMFLFQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXDVDQVQQHLEEVRFFDLFGFSEEAGAWQCFMCNNPEKATVVNQGGQPLM
EGKLKEKQVRWKFIKRWKTRYFTLAGNQLLFRKGKSKDDSDDCPIELSKVQSVKIVAKKR
RDRSLPRAFEIFTDNKTYVFKAKDEKNAEEWLQYINVAMAQVRERESREATTYL
Download sequence
Identical sequences ENSMEUP00000010933 ENSMEUP00000010933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]