SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Macropus eugenii 76_1.0 > ENSMEUP00000010968

Domain assignment for ENSMEUP00000010968 from Macropus eugenii 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMEUP00000010968
Domain Number 1	Region: 178-288
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	6.41e-17
Family	Spermadhesin, CUB domain	0.0034
Further Details:

Domain Number 2	Region: 127-167
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000000000641
Family	LDL receptor-like module	0.0015
Further Details:

Domain Number 3	Region: 383-420
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000196
Family	LDL receptor-like module	0.00069
Further Details:

Domain Number 4	Region: 22-124
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	0.000000126
Family	Spermadhesin, CUB domain	0.004
Further Details:

Domain Number 5	Region: 292-338
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000663
Family	LDL receptor-like module	0.0029
Further Details:

Weak hits

Sequence:	ENSMEUP00000010968
Domain Number -	Region: 341-382
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00367
Family	LDL receptor-like module	0.0025
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMEUP00000010968 Gene: ENSMEUG00000012047 Transcript: ENSMEUT00000012072
Sequence length	500
Comment	pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9524:3097:7997:1 gene:ENSMEUG00000012047 transcript:ENSMEUT00000012072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	GIAAHLDRTLFSNPACRDPPALLSGVQGILQWPQGRESRLLPITCIWVIVSSKEHTVTIX XXXXXLACGSEHLMLKSPLQPLISLCEAPSSSLRFSGGNVTITYSYTGNGRPLGQGFLLS YMQDRFTCLREEFRCLNHRCVPRAQRCDGVDDCGDQSDETGCSPSPFHSLTAVPAPACNR TLEDFYGVFSSPGYPHSVLYPTPHSCLWLLDPHDGRRLIVRFTTLELGKWDSVHVYDGSG PPDPARLLRNLNYFSNGKAIMVETLSGKATVTYHLGPWSAGGFNATYHVKGYCLPWDRPC GAGSGEGPGEGPGEGCYSEAQRCDGIWDCADGTDEKDCPGCLPGRYPCGAPGTPAATACY PAADRCNYQTFCVNGADEQQCRHCQPGNFRCSDDRCVYETWVCDGQPDCSDGSDEWDCAY ALPRKVITAAVIGSLICGLLLVIALGCTCKLYAIRTQEYSIFAPLSRVEAEIVQQQAPPS YGQLIAQGAIPPVDDFPTEN
Download sequence
Identical sequences	ENSMEUP00000010968 ENSMEUP00000010968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]