SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010975 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010975
Domain Number 1 Region: 131-351
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-48
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 356-486
Classification Level Classification E-value
Superfamily PH domain-like 6.33e-22
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010975   Gene: ENSMEUG00000012038   Transcript: ENSMEUT00000012080
Sequence length 773
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_159:20453:35237:1 gene:ENSMEUG00000012038 transcript:ENSMEUT00000012080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFSTPDEGHLVHGLVASRIETYGDSSHHRLQDFVSFTKNSAHSRGLSPLRLKDSEAEK
KYGGYFGSGPLNSPKIKEVAKAQQLEMRLHTFSMFGMPRLPPEDRRYWEIGEGGDSGLTI
EKSWKELVXXHKEMSREFCHQQEALWELMTTELCYVRKLKIMTDLLAAGLLNLQRVGLLT
EVIVESLFGNVPNLIRAHQSFWEEVLRPTLEKTRVSGQPLDPLNLKEGFLTVSQRFQPYI
QYCLHVKQTMAYAREQQENNPLFHTYVQWCEKHKRSGRQQLSDLLIKPHQRITKYPLLLQ
AVLKKTPEPQVQDVLGAMISSVEAFLHHINSQVRQGEDHDSLAAAAQRIGPYEVLEPSTE
EVEKNLRPFSNLDLTTPMLGVDHQHTRKLLLEGSVRMKEGREGKLDAYLFLFSDVVLVTK
PQRKADKAKVIRPPLMLEKLVCQALRDPNSFLMIHLTEFQCVSSALVFHCPSPNDCVRWL
EKIQEAQVTLQKLKTEEYVHQKRELLALYRDIESPGTRPPTPSPDSSQSSVEETSEFSAH
VPHLVVTEDREDSSPGLDDGSDSGYGTIPGSLQGSQSPLIRRRRPAIRQDPRLTLSTLDL
RDIPRRFQSSNPHAPQRRSAPDLPEDIIQRGHSLPRRGPSPWSEKEEEEEGSSAGGDVVM
ETLNRARLRGQVPLSPSQVDSAGESPWDSSGEDEEESPLFLAPRRYSSSSSLRAEEMLLE
IREDLANQRIDAFSETVTEPRDSSPRKLTVAELQRMRGSQIIQLDTPTTSEVC
Download sequence
Identical sequences ENSMEUP00000010975 ENSMEUP00000010975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]