SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011207 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011207
Domain Number 1 Region: 191-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-50
Family DBL homology domain (DH-domain) 0.000000379
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.01e-39
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 
Domain Number 3 Region: 378-534
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 670-767,816-842
Classification Level Classification E-value
Superfamily SH2 domain 6.21e-22
Family SH2 domain 0.00077
Further Details:      
 
Domain Number 5 Region: 781-830
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000357
Family SH3-domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000011207
Domain Number - Region: 637-661
Classification Level Classification E-value
Superfamily SH3-domain 0.0346
Family SH3-domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011207   Gene: ENSMEUG00000012277   Transcript: ENSMEUT00000012327
Sequence length 846
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4340:7440:219897:-1 gene:ENSMEUG00000012277 transcript:ENSMEUT00000012327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWRQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLKGHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESVNDEEIYKSLPDLIDETRADDEEDLYDCVYGEDEGGEVYEDLMKAE
EAQQPKCLENDIRSCCLAEIKQTEEKYTETLESIEKYFMTPLKRFLTATEFDTVFINIPE
LVKVHRSLTQEINDSIVNKNDQNLYQIFINYKERLVIYGQYCSGVESAISGLDFISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPIEKANLKQALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLVFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGTLKPEKPPNGLRRLPRQVDPGLPKMQVIK
NYTGNPQPPQQEGPPLXXXXXXXXXXXXXXXXXXXXXGRNLASGEIGFFPSEAVKPCPCX
XXXXXXXXXXXYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKI
LTRDGFFHIAENRRFKSLMGLVEYYINHSLKEGFRTLDTTLQFPYKEPENSAGQRGNRAS
SNLLSPKVLGIAIARYDFCARDMRELSLSKGDVVKIYTKMSVNGWWRGEANGRVGWFPST
YVEEDE
Download sequence
Identical sequences ENSMEUP00000011207 ENSMEUP00000011207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]