SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011343 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011343
Domain Number 1 Region: 1232-1393
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-73
Family Pleckstrin-homology domain (PH domain) 0.000000055
Further Details:      
 
Domain Number 2 Region: 1030-1231
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-51
Family DBL homology domain (DH-domain) 0.00000000536
Further Details:      
 
Domain Number 3 Region: 436-542
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000257
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 4 Region: 857-915
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000266
Family PDZ domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011343   Gene: ENSMEUG00000012413   Transcript: ENSMEUT00000012478
Sequence length 1583
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_6314:3019:106902:-1 gene:ENSMEUG00000012413 transcript:ENSMEUT00000012478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTESQNVEHRFYGEKQGNLSRKHTSHSLRLSNKTRRMRHASSARVIHRNSEVSTRSSS
TPSIPQSLAENGMEPFSQEGNLEDFGSPVWVGRVGMGLRPVSCHTDSSITPSIDSSTILT
AASAQSMPNSEENRLYGNDSTYLPEGGRRQRPYTTNGTTFMETSSFKKKRSKSADIWRED
SLEFSLSDLSQEHLTSNEEILGSVEERDRGVDRGMEARDGSQQLSTCHRANSLGVLYVPE
NNGVKANHGPRSKFVGYCGNLMSDVPDLANRKMPSAVAEDTPPYSNYNTLPCRKSHCLSE
ATNSQISHSSMGRAKXXXDVNIGEGSEFADSGIEGATIDTDLLSRRSNATNSSYSPTTSR
AFLGSDSGSSSTGDAARQGVYENFRRELEMSTNNSESLEEAGSAHSDEQSSGTLSSLGQS
DILLSAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYXXXXXXCTLFFYESDGRS
GIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTISQTELENWITAIH
SACATAVARQHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGDMQLSSVTDSKKKKTILDH
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXVAARTGETGVRRRTQAMSRTASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGDDTI
KKSLEGIYDDTVPDGKREKEVVLSSVHQHNPDCDIWVHEYFTPSWFCLPNDQPALIVVHP
GDTARDILELICKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXFSISSVEEEGVQRLYVNNVKETGLASKKGLKTGDEILEINNRAA
DTLNSSMLKDVLTQLSLCLIVQTYPELVGGQKLLETPPHRVDSLADFSDSPFAFLTSNPV
NSLCSEQVRSADMTPEETDVHDLESSEEGDKTSKSTEQDAAFEVNPSDLSLLPQECTGPQ
LVTMRQLTDADKLRKVICELLETERTYVKDLNCLMESYLKPLQKETFLTQDELDVLFGNL
TEMVAFQVEFLKTLEDGVRLVPDLDKLERVDQFKKVLFSLGGSFLYYADRFKLYSAFCAS
HTKVPKVLVKARTDTAFKAFLDAQNPEQQHSSTLESYLIKPIQRILKYPLLLKELFALTD
EESEEHSYLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQMGEKKEVADLSMGDLL
LHTTVIWLNPPASLGKWKKEPELAAFVFKMAVVLVYKDGSKQKKKLVGSHRLSIYEEWDP
FRFRHMIPTEALQVRALTSADAEAHSVCEIVHIKSESEGRPERSFHLCCSSPESRKDFLK
AVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLYPLKGARPAMSRAVSAPSKSLGRRRR
RLARNRFTIDSDAVSTSSPKTESQHPSSGRDTDRWVEEQFDLAQYEEQDDIKETDILSDD
DEYCKSMKGSPVDRDLQEQLQAASLSQRERGQQAMDSHASRMTQLKKQAALSGINGGLEN
ASEEVIWVRREDFVPTRKLNTEI
Download sequence
Identical sequences ENSMEUP00000011343 ENSMEUP00000011343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]