SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011431 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011431
Domain Number 1 Region: 266-445
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.18e-48
Family DBL homology domain (DH-domain) 0.000000273
Further Details:      
 
Domain Number 2 Region: 431-569
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-44
Family Pleckstrin-homology domain (PH domain) 0.000003
Further Details:      
 
Domain Number 3 Region: 146-204
Classification Level Classification E-value
Superfamily SH3-domain 9.71e-20
Family SH3-domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011431   Gene: ENSMEUG00000012542   Transcript: ENSMEUT00000012573
Sequence length 652
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8773:4005:54350:1 gene:ENSMEUG00000012542 transcript:ENSMEUT00000012573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VASSDTSDQNVSLDYPRGCRKRRPISVIGGVSFYGNNQTEEIENLLTQPVTRPPVPAHQV
PPYKAVSARLRPFTFSQSTPIGLDRVGRRRQMRASNXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLISDGNVVCAEALWDHVTMDDQELGFKAGDVIQVLEAS
NKDWWWGRNEDKEAWFPASFVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXGYIRQCRKHTGMFTVAQLGTIFGNIEEIYKFQRKFL
KDLEKQYNKEEPHLSEIGSCFLQHQEGFAIYSEYCNNHPGACLELSNLMKQGKYRHFFEA
CRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHSDYNNIKAAYETMKNVACL
INERKRKLESIDKIARWQVSIVGWEGLNILDRSSELIHSGELTRITKQGKSQQRTFFLFD
HQLVFCKKDLLRRDMLYYKGRMDMDEMELIDIEDGRDKDYNINIKNAFKIINKSTEEVYL
FCAKKQEDKVRWLQACADERRRVKEDKEMXXXXXXXXXXXXXXXXXXXXXXXXXXYNGCS
VPPPHQSLHPIHQRHITVPTSIPQQQVFALAEPKRKPSLFWHTFNKLTPFKK
Download sequence
Identical sequences ENSMEUP00000011431 ENSMEUP00000011431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]