SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011564 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011564
Domain Number 1 Region: 369-553
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-48
Family DBL homology domain (DH-domain) 0.00000202
Further Details:      
 
Domain Number 2 Region: 54-209
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.35e-42
Family Regulator of G-protein signaling, RGS 0.000000876
Further Details:      
 
Domain Number 3 Region: 598-732
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-38
Family Pleckstrin-homology domain (PH domain) 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011564   Gene: ENSMEUG00000012647   Transcript: ENSMEUT00000012717
Sequence length 833
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_982:2158:15679:1 gene:ENSMEUG00000012647 transcript:ENSMEUT00000012717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGRASPHSPAEMEMEDAARGVPGSSQPGAPVSIIGAEDEDFENELETHPEERSSQFQSLE
QVKCRPAHLMALLHHVALQFEPGPLVLRVPTPLSVFELDRTRPELLPEETQRRFLQEVVR
AQQNAVSRQLEDFRSKRLMGMTPGEPDLSQLETWAARDRVTFEARERLVAERMLNRLEDI
HPTISPDEEKSVAIVNAISAYMRYLGVRTKSSDKKARGNFFRKKNRRPDDATKTRKAFIS
ILDAARWNRGEAQAPDLRHPKAESEGEKLGLPERKISQVTPPKGMTGPPGPDAPGVTVHP
PPGESPDKEPGTDPPSEVGDPPPQGPSNSESPVLPDSSTEEGADTESPEPGEEGESGRAG
LELEPEEPPGWRELVPPDTLSGMHKNQVKRQEVISELLVTEAAHVRMLRVLHELFYQPMA
DGGFFTMDELQNIFPSLDELIDVHSLFLENLMKLRQESGYLIEEIGDVLLARFDGAEGSW
FQKISSRFCSRQSFALEQLKAKQKKEPRFCTFVQEAESRPRCRRLQLKDMIPTEMQRLTK
YPLLLQSIWQNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLKDYQRRLDLSHL
RQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLL
KSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHRAFYVIFTWDQEAHIYELVAQTVSE
RKHWCTLITETAGSLKVPAPLGRSRSRQSPISTREPLISISENGNNSRDTSQAEGRCERL
LTDLLPFSCLDPEGQLAASALREGSRGRILPAPTRHIPAQWGHPQPGWLLLRP
Download sequence
Identical sequences ENSMEUP00000011564 ENSMEUP00000011564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]