SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011657 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011657
Domain Number 1 Region: 628-689,896-1236
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-118
Family Ras GEF 0.0000143
Further Details:      
 
Domain Number 2 Region: 23-132
Classification Level Classification E-value
Superfamily PH domain-like 3.27e-18
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 3 Region: 297-386
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000000314
Family DBL homology domain (DH-domain) 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000011657
Domain Number - Region: 521-589
Classification Level Classification E-value
Superfamily PH domain-like 0.00311
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011657   Gene: ENSMEUG00000012755   Transcript: ENSMEUT00000012819
Sequence length 1239
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2766:1284:164513:1 gene:ENSMEUG00000012755 transcript:ENSMEUT00000012819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERAPAPPKAASGAAGGKDALNKQYYFTVLFGHEGQKPLELRCEEEHE
GKEWMDAIHQASYSDILIEREVLMQKYIHLVQIVETEKIASNQLRHQLEDQDTEIERLKS
EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQSFMRGWLCRXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXIMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGGVLSLIECTLIEEPDASEDDS
KGSGQVFGHLDFKIVVEPPDSAPFTVLLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVF
EENSKVTVPHVIKSDARLHRDDKDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLEKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLADGKSPH
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLSASSTTSSPTSAYSPATSPP
PHTGKVPLDLSRGPSSPEQSPGSLEENLDNPRMDLCNKLRRNIRRAVLETVSGDRTVSES
NPALDKAELSPCRSPSTPRHLRYRSPGGQTADNPHCSVSPASAFAIATAAAGHGSPPGFN
NSERTCDKEFIIRRTATNRVLNVLRHWVSKHSQDFEFNNELKMNVLNLLEEVLRDPDLLP
QERKATANILRALSQDDQDDAHLKMEDIIQTPDCPKAECFETLSAMELAEQITLLDHIVF
RSIPYEEFLGQGWMKLDKNERTPYVMKTSQHFNDMSNLVASQIMNYADVSSRANCIEKWV
AVADICRCMHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKIVSSEGRFKN
LRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQT
FYRIDHQPKVTQYLLDKTLIIDEDTLYELSLKIEPRLPA
Download sequence
Identical sequences ENSMEUP00000011657 ENSMEUP00000011657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]