SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011908 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011908
Domain Number 1 Region: 866-925
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000985
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 798-860
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 446-497
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000131
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 4 Region: 276-383
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000196
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 5 Region: 387-448
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000473
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 621-664
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000811
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 7 Region: 561-600
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000229
Family Complement control module/SCR domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011908   Gene: ENSMEUG00000013036   Transcript: ENSMEUT00000013096
Sequence length 1018
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1539:13741:109267:1 gene:ENSMEUG00000013036 transcript:ENSMEUT00000013096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTGPPAAGRLPLSLLLVLLLGSQAAQLEVDVYPEGRVGPSSPYHLHPEELANNKISKE
NAEGRVVLPSAVQPGEEDAEMELKGTAPAHLENLPMSTVLAEASGKHTFPPRKKPPSLKQ
VNTARKHLRPKTLPSMLQRMASQPAPSNPGFFSFXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCSITFSDPEGYIDSNDYIPLPLHSF
LECTYNVTVYTGYGVELQVKSVNLSEGELLSIRGVDGPNLMVLANQTLLVEGQVIRSPTN
TISVYFRTFQDDGIGTFQLHYQAFMLSCSFPRRPAFGDVTVMDLHSGGLAHFHCYLGYEL
QGAKTLTCINASKPHWSSQEPICSAPCGGIVHNATIGRVLSPSYPGNSNGSQVCVWTIEA
PEGQKLHLHFERLFLSEKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXFEKGHCYEPYIQNGNFTTSDPTYNIGTTVEFTCDPGHSLEQDAI
ICINXXXXXXXXXXXXXXXMCGGELSAVAGVVLSPNWPEPYAEGEDCIWKIHVGEEKRIF
LDIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXVSRNDSCSDLPEIQNGWKTTSHTELVRGAXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNAGFVLEGSSLL
TCYSRETGTPIWTSRLPHCVSEETLACDNPGLPENGYQILYKRLYLPGESLTFMCYEGFE
LMGEVTIKCILGQPSHWSGPLPVCKXXXXXXXXXXXXAEAAAETSLEGGNMALAIFIPVL
IISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREYEVSI
Download sequence
Identical sequences ENSMEUP00000011908 ENSMEUP00000011908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]