SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011997 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011997
Domain Number 1 Region: 533-703,758-857,895-1009
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-94
Family Ras GEF 0.00000000000754
Further Details:      
 
Domain Number 2 Region: 1-143
Classification Level Classification E-value
Superfamily Histone-fold 1.11e-47
Family TBP-associated factors, TAFs 0.000000658
Further Details:      
 
Domain Number 3 Region: 164-364
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-42
Family DBL homology domain (DH-domain) 0.00000000466
Further Details:      
 
Domain Number 4 Region: 450-538
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-17
Family Pleckstrin-homology domain (PH domain) 0.0000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011997   Gene: ENSMEUG00000013132   Transcript: ENSMEUT00000013190
Sequence length 1299
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_3001:6975:88710:-1 gene:ENSMEUG00000013132 transcript:ENSMEUT00000013190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPTLASNEDALQYVEELILQLLSMLCQAQPRSVLDVEDRVQKSFPHPIDKWAIADAQSAN
EKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRH
YEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLVKAFMAEVRQ
YIRELNLIIKVFREPFVSNSKLFSXXDVENIFSRIADVHELSVKLLGHIEDTVEMTDEGS
PHPLVGSCFEDLAEELAFDPYESYAQDILRPGFHDHFLSQLSKPGAALYLQSIGEGFKEA
VQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNLQSSMERICSKS
LAKRRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAF
EIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSSDL
YRFAEPDSEENIVFEENMQPKSGIPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSF
CKPQELLSLLIERFEIPEPEPTEADRIAMENGDQPLSVELKRFRKEYIQPVQLRVLNVCR
HWVEHHFYDFERDTDLLQRLEEFIGTVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVQPSELVGSVWTKEDK
EINSPNLLKMIRHTTNLTLWFEKCIVEAENLEERVAVVSRIIEILQVFQELNNFNGVLEV
VSAMNSSPVYRLDHTFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYL
TNILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENL
NPMGNSMEKEFTDYLFNKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPT
PLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFH
SSSDTIFIQVTLPHGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXSDRTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQ
PPPLGKKSEHGNTFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQDVDIHSIPGPPVPP
RQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
Download sequence
Identical sequences ENSMEUP00000011997 ENSMEUP00000011997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]