SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012009 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012009
Domain Number 1 Region: 76-131
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000588
Family C-type lectin domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000012009
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0848
Family C-type lectin domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012009   Gene: ENSMEUG00000013160   Transcript: ENSMEUT00000013202
Sequence length 208
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4629:3221:14216:-1 gene:ENSMEUG00000013160 transcript:ENSMEUT00000013202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPSSTWVQFQSNCYIFLQTTVQIENIEDVRNQCTDSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXESFKWYDKSNMTFNKWKNSEESQDLIDTCGFLQTKSGIWRKGNC
EVSSVEGALCKAAXXXXXXXXXXNHILITALVIASTTILTITGAVLWFLYKRNLTSGLTH
TAYTTAPQLPYNDDCILVDAEENEYVAF
Download sequence
Identical sequences ENSMEUP00000012009 ENSMEUP00000012009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]