SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012091 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012091
Domain Number 1 Region: 15-232
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.7e-36
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 221-362
Classification Level Classification E-value
Superfamily PH domain-like 7.77e-33
Family Pleckstrin-homology domain (PH domain) 0.00054
Further Details:      
 
Domain Number 3 Region: 674-743
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000021
Family PDZ domain 0.017
Further Details:      
 
Domain Number 4 Region: 481-606
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000256
Family DEP domain 0.0071
Further Details:      
 
Domain Number 5 Region: 414-448
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000348
Family DEP domain 0.034
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000012091
Domain Number - Region: 594-636
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00405
Family PDZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012091   Gene: ENSMEUG00000013218   Transcript: ENSMEUT00000013297
Sequence length 1607
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_438:3828:218909:1 gene:ENSMEUG00000013218 transcript:ENSMEUT00000013297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEESKGEGKGESGKDVEKQLRLRVCVLSELLKTERDYVGTLEFLVSAFLHRMIQCAASK
VDKNVTEETVKMLFSNIEDILSVHKEFLTVVEECLHPEPNAQQEVGTCFLHFKDKFRIYD
EYCSNHEKAQKLLLELNKIRTIRTFLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XELLKRTPRKHSDYAVLMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT
DTCTEMLMYGVLLKISAGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRI
NTEVMEVENVDDGTADFHSSGHIVLNGWKIHNTAKNKWFVCMAKTPEEKHEWLEAIMKER
ERRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFVSWLL
EIGEIHKPEEGVHLGQALLENGIIHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQXXXXXXXXXXXXXXXXX
XXXXXXXXLEKSEFKDEPLLFRFFADEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNE
GSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXTVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII
KVNGINVSKETHASVIAHVTACRKYRRPMKQDSIQWVYNSIESAQEDLQKTNSKPPDDGG
DAFDCKVEEVIDKFNTMAIIDGKKDHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMIE
PKGFFSLTAKILEALAKSDEHFVQNCTSLNSLNEVIPPDLQSKFGTICSDKIEHICRRIS
SYKKVKILSFNIETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXPQFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFG
VQRKLNPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXFSDCNSNRNSIASFTSICSSQCSSYFHSDEMDS
GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKCFTAGRGLQE
FQQEMEPKLSCPKRIRLHIKQDPWNLPSSVRNLAQNIRRFVEEVKSRILLALLEYTDSEL
QLRRDMVFCQSLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFH
FQSLLSPNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPLTYQAEGSRQXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLESMEGYYYRDSVSVEEFQAQINAASLE
KVKQYNQKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTLSVTLEQAIILARSHGLPPRYI
MQATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCQPPPPAGEE
Download sequence
Identical sequences ENSMEUP00000012091 ENSMEUP00000012091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]