SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012105 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012105
Domain Number 1 Region: 495-627
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.7e-30
Family Ricin B-like 0.0026
Further Details:      
 
Domain Number 2 Region: 283-493
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9.79e-28
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000102
Further Details:      
 
Domain Number 3 Region: 164-227
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000000003
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012105   Gene: ENSMEUG00000013271   Transcript: ENSMEUT00000013313
Sequence length 631
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2942:13906:44562:-1 gene:ENSMEUG00000013271 transcript:ENSMEUT00000013313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHIRLLIKLFCKKLFHHKKLWKFGAVIFFFMVFLILMQREVSIQDSKDVSGIEKNKNKM
FDLMIEAVNNIKDVMPKLQIKAPVRQDNNAGDRPCLQGHYTAAELKPFLDRPPQDSNAPG
ASGKPFKPENLSPEEQKEKENGEAKHCFNAYVSDRISLHRDLGPDTRPPECIEQKFKRCP
PLPTTSVIIIFHNEAWSTLLRTVHSVLYSSPAVLLKEIILVDDASEDXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXECFYGWLEPLLSRIAENYTAVV
SPDIASIDLNTFEFNKPSPYGHNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIRTPTF
AGGLFSISKDYFEYIGTYDEEMKIWGGENIEMSXXVWQCGGQLEIMPCSVVGHVFRSKSP
HTFPKGTQVIARNQVRLAEVWMDEFKDIFYRRNTEAAKIFKQKTFGDISERLEIKHRLQC
KNFTWYLNNVYPEIYVPDLNPVISGYIQNKGRHSCLDVGENNQGGKPLIMYTCHGLGGNQ
YFEYSAQHEIRHSIQQELCLHAIQGPVQLKTCSYKGQKTLTVGEQKWEIRKDQLLYNPSL
NMCLTGNGEHPSLMPCNPSDVFQQWDFVHQD
Download sequence
Identical sequences ENSMEUP00000012105 ENSMEUP00000012105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]