SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012158 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012158
Domain Number 1 Region: 187-392
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-44
Family DBL homology domain (DH-domain) 0.0000000645
Further Details:      
 
Domain Number 2 Region: 2-235
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.37e-39
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 784-838
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-21
Family SH3-domain 0.00064
Further Details:      
 
Domain Number 4 Region: 510-565
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000147
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0073
Further Details:      
 
Domain Number 5 Region: 669-766,810-836
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000364
Family SH2 domain 0.0028
Further Details:      
 
Domain Number 6 Region: 613-657
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000184
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 7 Region: 379-434
Classification Level Classification E-value
Superfamily PH domain-like 0.000000545
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012158   Gene: ENSMEUG00000013321   Transcript: ENSMEUT00000013371
Sequence length 844
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5201:921:25718:1 gene:ENSMEUG00000013321 transcript:ENSMEUT00000013371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCAHWLIQCRVLPPNHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAVNLREI
NLRPQMSQFLCLKNIRTFLSACCEKFGLHRSQLFEVFDLFDVQDFGKVIYTLSALSWTTI
AQNKGIMPFPTNDDNLGDDDIYSGLSDQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPKMTELDKRICCLREIQQTEEKYTDTLSSIQQHFLKPLQRFLRSEDIEIIFINL
EDLLSVHSSFLRDLKEALSANGAPDLYVFINYKERFLIYGRYCSQVESASKHLDRVANMR
EDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQXXXXXXXDATEKENMRLALD
AMRDLAQCVNEVKRDNETLKQITTFQLSIENLTKNLAPYGRPKIDGELKITTSERRSKID
RYAFLLDKALLICXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXSNIYPENATANGHDFQMFSFEETASCKACQMLLRGTFY
QGYRCHRCRAPAHKECLGRVPPCGRHSSXXXXXXXXXXXXXXXXXXXXXXXXLPKMEVCQ
EYYGLPPPPVAFGPFLRLNLGDIVELTKAEAEQNWWQGRNTATNETGWFPCKKVKPYVHX
XXXXXXXXXXYAGPMERAGAESILTNRSDGTFLVRQRVKDSAEFAISIXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXELVEFYQQNSLKDCFKSLDTMLQFPYKEPERRAIARAPAGNT
RYFGSAKARYDFCARDRSELSLKEGDIIKIISKKGHQGWWRGEIYGRIGWFPSNYVEEDY
SEYC
Download sequence
Identical sequences ENSMEUP00000012158 ENSMEUP00000012158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]