SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012373 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012373
Domain Number 1 Region: 77-188
Classification Level Classification E-value
Superfamily C-type lectin-like 1.26e-27
Family C-type lectin domain 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012373   Gene: ENSMEUG00000013570   Transcript: ENSMEUT00000013607
Sequence length 189
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2474:50625:53280:-1 gene:ENSMEUG00000013570 transcript:ENSMEUT00000013607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NEDLKKTPEKEEILNKEQEISDEEENLASGEDDSWWEKKEAPELVPVPVTKEDDNVCPKE
EDIVHLTGSPECQGCRYVLIRQPRIFQNAQAVCQRCYRGRLISIHNYNSNYLMYRTVGIS
QAQVWIGGYVTGWGPCKRYYWLDGSRWDFAYWAYGQPGNGGGNCVALCTKGGHWRRAPCI
RRLPFICSY
Download sequence
Identical sequences ENSMEUP00000012373 ENSMEUP00000012373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]