SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012543 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012543
Domain Number 1 Region: 434-566
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-42
Family Nuclear receptor ligand-binding domain 0.000097
Further Details:      
 
Domain Number 2 Region: 88-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-25
Family Nuclear receptor 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012543   Gene: ENSMEUG00000013747   Transcript: ENSMEUT00000013785
Sequence length 568
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_8265:24079:50597:1 gene:ENSMEUG00000013747 transcript:ENSMEUT00000013785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVIAYISSSSSASSPASCHSEGSESSFQSSPSSVPSSPNSSDSDCNGNSNAEGTSKSDRT
DGPVKSSKSSVTGMTKGPSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQ
QNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDXXXXXXXXXXXXXXXXXXXX
XXXXXXMTSQFSGHLQSEALVEHHGQTTLPAQEHLRPKPQMQQENMKSPSPPPSDFAKEE
VIGMVTRAHQDTFMYNQEQQEHSTEIMQHPRGERIPKSMEQYNLNHDHCSSGLGGSHYLN
SESQHHLSGQYKGRSIMHYPNGRAVCVTNGHCMNFSNGYTQRLCNQMPVDGFSQNENKNS
YLCNTGGRMHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXVLMVRFASLFDAKERTVTFLSGKKYSVDDLRSMGAGELLNSMFEFSE
KLNSLQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIF
TKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences ENSMEUP00000012543 ENSMEUP00000012543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]