SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012567 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012567
Domain Number 1 Region: 14-131
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-31
Family C-type lectin domain 0.00000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012567   Gene: ENSMEUG00000013778   Transcript: ENSMEUT00000013814
Sequence length 133
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_10012:456:2081:-1 gene:ENSMEUG00000013778 transcript:ENSMEUT00000013814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSNPKAPSNRNGFYCGPCPKNWVCYKNICYHFSNESKSWNQSRASCLSHNSSLLKIYSKE
XXDFLSLVRTYHWMGLIQSTSTGSWMWEDGAPLSSEVLSLIPVQKGNCAVYGSSFKGYTE
NCSSTNAYICMQK
Download sequence
Identical sequences ENSMEUP00000012567 ENSMEUP00000012567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]