SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012623 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012623
Domain Number 1 Region: 123-298
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.72e-54
Family Crystallins/Ca-binding development proteins 0.0000756
Further Details:      
 
Domain Number 2 Region: 311-479
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 3.93e-47
Family Crystallins/Ca-binding development proteins 0.00041
Further Details:      
 
Domain Number 3 Region: 483-612
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.74e-19
Family Ricin B-like 0.0096
Further Details:      
 
Domain Number 4 Region: 70-112
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000000119
Family Crystallins/Ca-binding development proteins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012623   Gene: ENSMEUG00000013828   Transcript: ENSMEUT00000013878
Sequence length 615
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_8358:1488:12826:-1 gene:ENSMEUG00000013828 transcript:ENSMEUT00000013878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRVSGTAWSPVTIGSLRRIIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXWLLYSKPYYTGVPCILEPGVYPTPEAWGSSDPHVNSLKPLRLGCPTVEKP
GEPKALVYEATDFQGHCWEVSRDIYDLRNPEDEQSPSLATVGSLRILGGCWVGYEKEGFR
GHQYLLEEGEYPDWSHWGGYDESLTSLRVIRTDFSDPAVMLFEAADFEGQSVGLSDALPD
VQLAGHSLTTQAHVXXXXWVAYEQVGFSGEQYVLEKGVYRNCDDWGAGNSTITSLQPILQ
VGEHNLHFVSKIQLFSGPDFLGDHISFEDDQASLPSSFQPQSCRVHGGSWILFEKQEFEG
EQHVLSEGEFPTLTAMGCLASTSLSSLRKVPLHFSEPSIFLYGLECFEGKEIELNGEVRS
LQAEGFNNHVLSVRIKGGVWVLCEHSDFRGRQWLVGSTELTNWLTYSGTQRIGSLYPIKQ
RRVYFCLRNKGLGRWLAVPEDVEDMKAGRVVVSETRAGGSCIWYYEDGLLKNQVAPTMSL
QVIGQPSPGSKVVLWSESRQPRQTWNIDTSGHICSEMFEDKILDVKGGQGYDRDHAVLWD
RTEERPSQIWDVQVL
Download sequence
Identical sequences ENSMEUP00000012623 ENSMEUP00000012623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]