SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012684 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012684
Domain Number 1 Region: 111-282
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000411
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 50-86
Classification Level Classification E-value
Superfamily WW domain 0.0000000092
Family WW domain 0.0028
Further Details:      
 
Domain Number 3 Region: 14-44
Classification Level Classification E-value
Superfamily WW domain 0.0000117
Family WW domain 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000012684
Domain Number - Region: 703-766
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0562
Family Occludin/ELL domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012684   Gene: ENSMEUG00000013893   Transcript: ENSMEUT00000013945
Sequence length 1122
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_7434:29865:104417:-1 gene:ENSMEUG00000013893 transcript:ENSMEUT00000013945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAGVGRDSLEHWSYGVCRDGRVFFIDDQHRCTTWLHPRTGEPVNSGHMIRSDLPRGW
EEGFSEEGASYFIDHNQQTTAFRHPVTGQFSPENIEFILQEGPNPHMSKQEFMNQRPSSM
VSETSTVGTTSTLDMKSGPRVIKTSKIHSFGKRDQSIRRNPNVPVVVRGWLHKQXXXXXX
XXXXXXXXXXXXXXXXXXXSREEAVLGSIPLPSYVISPVGPEDRINRKYSFKAVHNGMRA
HIYSTSGIDFSAEHSGMRTYYFSADTQEDMTSWIRAMNQAAQLKSRASLKRDAERTERQA
VPQANHTDPCQECGRMGPGHTRGCSHRAHNEAFGFDRPEQDDEERYGFQRDPLEGNRERG
KPYPAAEADSFLVDLPSGPRAQSAQPQLMERNGMLPSSFGGGSGLGEQNGSGGYKRVTHP
RTNPEKHAQRRSNMAQVENWVKVQKGDGKSLVSDQTIPQQGPGQSLSFSENYQTLPKNTR
HSSGNSPPPLRNLPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEWQQRQQFKHGNPT
APIYAGSPEFADQGRSRSMLEVPRSISVPPSPTDIPPLGPPRLFPTRRPHTPAERVTVKP
LEQRRSVDISLGGSPRKVRGHTLKNSSHVDRRSMPSMGYMTHTVSAPSLHGKADDTYLQL
KKDLEYLDLKMTRDTLKDRSLKPVKVAESDIDVKLSILCEQDRVLQDLEDKIRALKENKD
QLESVLEVLHRQMEQYKDQPQHSEKISYQQRLLQEDLVHIRAEISKLSTXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDSGYQTLPGRXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPKSALERLYSGDHLRGKMSAEEQLERM
KRHQKALVRERKRTLSQGEKQNMASSHTFSRASPGDLGSVCY
Download sequence
Identical sequences ENSMEUP00000012684 ENSMEUP00000012684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]