SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012741 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012741
Domain Number 1 Region: 29-283
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-68
Family Nuclear receptor ligand-binding domain 0.00000691
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000397
Family Nuclear receptor 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012741   Gene: ENSMEUG00000013979   Transcript: ENSMEUT00000014009
Sequence length 297
Comment pep:known_by_projection scaffold:Meug_1.0:Scaffold34232:2514:7415:1 gene:ENSMEUG00000013979 transcript:ENSMEUT00000014009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHTHSGGSPTALEVGVEYFNGQ
PVSELISQLLRAEPYPAARYGSVCPAAAVLGIDNICELAARLLFSTVEWARNIPFFPELP
VADQVALLRLSWSELFVLNAAQSALPLHMAPLLAAAGFHAAPMAADRVVSFMDQIRVFQE
QVDKLNRLQVDSAEYSCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQP
QRFGRLLLRLPALRAVPAALISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYAAGQ
Download sequence
Identical sequences ENSMEUP00000012741 ENSMEUP00000012741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]