SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012764 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012764
Domain Number 1 Region: 642-810
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000701
Further Details:      
 
Domain Number 2 Region: 129-283
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-32
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 
Domain Number 3 Region: 502-617
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000514
Family Synaptotagmin-like (S variant) 0.03
Further Details:      
 
Domain Number 4 Region: 299-338,404-459
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000661
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012764   Gene: ENSMEUG00000013978   Transcript: ENSMEUT00000014035
Sequence length 858
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_7559:15881:175901:-1 gene:ENSMEUG00000013978 transcript:ENSMEUT00000014035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLSHRGLPRLSWIDTLYSNFSYGADDYDGEGNEEQKVPPEGSETMPYIDESPTMSPQL
SARSQGGGDGIFPPPPEGLGPVVEAGKGLEMRKLVLSGFLAXXXXXXXXXXXXXXPMKPL
KATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTLGHLFQKLASQ
LGVYKAFVDNYKIALETAEKCSQSNNQFQKISEXXXXXXXXXXXXXXXXXXXXXMLNKPI
GQVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETR
QLVKDGFLVEMAESSRKLRHVFLFTDVLLCAKLKKTSVGXXXXXXXXXXXXXXDLFPSPE
ESEPSPQVHPFPDHELEDMKMKISALKSEIQKERANKGQSRAIERLKKKMFENEFLLLLN
SPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFK
LRTVHNIPVTSNKDDDEAPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTR
VFRDTMEPQWNEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDPQ
TVQTKNWHMDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVP
YIVRQCVEEVEKRGIEEIGIYRISGVATDIQALKAVFDANNKDVLVMLSDMDINAIAGTL
KLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRTLPDPNLITFLFLLEHLKR
VAEKEPINKMSLHNLATVFGPTLLRPSEVESKGHLTSASDIWSHDVMAQVQVLLYYLQHP
PISFAELKRNTLYFSTDV
Download sequence
Identical sequences ENSMEUP00000012764 ENSMEUP00000012764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]