SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012912 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012912
Domain Number 1 Region: 431-553
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.57e-38
Family Ricin B-like 0.000000699
Further Details:      
 
Domain Number 2 Region: 233-387
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.19e-21
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000382
Further Details:      
 
Domain Number 3 Region: 95-159
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000000000319
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012912   Gene: ENSMEUG00000014150   Transcript: ENSMEUT00000014195
Sequence length 559
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5155:7808:81696:1 gene:ENSMEUG00000014150 transcript:ENSMEUT00000014195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKFAYCKVVLATSLIWVLLDMFLLLYFSDCNKCDEKKERGLPAGDVLEPVQKPHEGPGE
MGKPVAIPKEDQEKMKEMFKINQFNLMASEMIALNRTLPDVRLEGCKTKVYPDNLPTTSV
VIVFHNEAWSTLLRTVHSVINRSPRHMLEEIVLVDDASERXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTVVCPIIDV
ISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDR
HYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQ
IINKNNRRLAEVWMDEFKNFFYIISPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDD
LCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC
SGSRSQQWLLRNVTLPEIF
Download sequence
Identical sequences ENSMEUP00000012912 ENSMEUP00000012912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]