SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012970 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012970
Domain Number 1 Region: 197-341
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-25
Family DBL homology domain (DH-domain) 0.0006
Further Details:      
 
Domain Number 2 Region: 332-470
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-18
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 3 Region: 467-542
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-18
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012970   Gene: ENSMEUG00000014212   Transcript: ENSMEUT00000014255
Sequence length 577
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_689:9893:80763:-1 gene:ENSMEUG00000014212 transcript:ENSMEUT00000014255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESSSTPGTVATPEEYPALATDSPTTLTEALKMIHPIPADSWKIFIEQIGLLYQEYRDKST
LHEIETRRLQDAEVQVDVDESPTSEETPPEEEEPPSSTEKKALPQICLLNNANSRFNLWQ
DLPEIRSSGVLDILQPDEIRLQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXFLLELEHRMEENIVISDVCDIVHQHAANHFSVYITYVSNQTYQ
ERAYKQLLXXXXAFREVISQLELDPKCKGLPFSSFVILPFQRITRLKLLVQXXXXXXXXX
XXXXXXXXXXXXXXXXVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQ
GELQQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGDKYQVFDSASRGLLRVEEL
EDQGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLD
CPQVQCVHPYVAQQPDELSLELADILNILEKTEDGWIFGERLHDQERGWFPSSMVEEIMN
PKIRSQNLKECFRVHKMDDTQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences ENSMEUP00000012970 ENSMEUP00000012970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]