SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013019 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013019
Domain Number 1 Region: 193-376
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.66e-26
Family Clostridium neurotoxins, the second last domain 0.053
Further Details:      
 
Domain Number 2 Region: 622-698,731-749
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000163
Family Zinc protease 0.079
Further Details:      
 
Domain Number 3 Region: 1451-1525
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000089
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 1391-1457
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000222
Family Complement control module/SCR domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000013019
Domain Number - Region: 775-812,996-1041
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000268
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number - Region: 474-564,653-705
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00278
Family Zinc protease 0.079
Further Details:      
 
Domain Number - Region: 1517-1573
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00502
Family Complement control module/SCR domain 0.0095
Further Details:      
 
Domain Number - Region: 1327-1394
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0209
Family Complement control module/SCR domain 0.0076
Further Details:      
 
Domain Number - Region: 1652-1681
Classification Level Classification E-value
Superfamily Notch domain 0.0418
Family Notch domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013019   Gene: ENSMEUG00000014237   Transcript: ENSMEUT00000014307
Sequence length 1714
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_3034:1810:239932:1 gene:ENSMEUG00000014237 transcript:ENSMEUT00000014307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLTVLGMTVVVLTGGVFSVADSDLGWERKQSLVLRGQLNQVSAEGEPCWLGTRVRRPR
AAPLHHLFGVYPSRRVDYFHPYPIREQKDKQGISTLLSGSRLGDVLQIGDNPSKQSDDIH
FGNQGYLESLSESGTKERAAVGTEAPTPTRPEPESQRKGEVRVRHRRQAQEECRELGGKP
SWGGATFNSQEGMPILYFSGRREQLLVRPEVMVEIPREAFTVEAWVRPEGGQNNPAIIAG
VFDNCSHAVSDKGWALGIRSVEHHGRKDARFFFSLRTDRVKKATVVTGHSRYLSGTWTHL
VAATYDGRRIALYVDGAQVASSLGQSGPLHSPFMASCRSLILGGDSSEDRHQFRGHMGTL
TLWSTALQQSQLQQSFLQPSGYGDLASLALSANFAPMTEWVTFKDGEFPRLEMLQDPEPE
PEILYPLMPPPCGQTACDNVELISQYNWHWPLRSEKVIRYQVVNVCDDDGLHPTVSSEQI
TRQHQALSAAFSRYNISWQLSVHEVHNSTLRYRAVLVNCEPSKIGNDHCDTECEHPLTGY
DGGDCRLQGRCYSWNRRDGVCHMECNNMLDDFDDGDCCDPDVTDVQKTCFDPDSPKRAYM
SVKELKEALQLNSTHFLNVYFASSVREDLAGAATWPWDKEAISHLGGVVLNPTYYGMPGH
TNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETTPTMDTGDLCADTAPTPKSKLCQDPE
PTNDTCGQNHFSGTPFNNYMSYTDDDCTDHFTPNQVARMHCYLDLVYQQWSDSKKPTPIP
IPPMVIGQTQDSLTIHWLPPISGVLYERDAGSLCGVCTEDGTFRQYVHSASSRRVCDSSG
YWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPAEGCSLELLFLHPVHADSLT
LWITYLSMDSSQALFDLEVLMENHKSIHLGPLDTFCDTPLTVKLNVKWKVSGVKVYTFDE
RMEIDAALLTSKPHSPLCSGCRPVKYQILRDPPFKSNSPVMVAHRHRKFTDKEVTPGLVY
QYQIQAAAGTELGEASPPLIHIHGKPYCGDGQVTXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXEPSLCYIYEGDGICEPFEKMNSILDCGLYTPKGYLDQWATQAYTSHQDNKMCPV
SLVTGEPLSKVCKSHHPKSPEDCPLGGWFPCIASEDRKQPELDVERNEKIWLKVCFDRPG
VATTVFIFLASDGMVHGEKQRPTVTLLLSDASGQNHSLGTYELSCQHNPLTVNVTHNPNF
LFHQTTSVMLNFSSPFVGISAVALRTSLNINPSAPNNCIPGHEGHGHQRPSCTHQSYGEQ
GSCVPLLLDHADVVNCTSSSPGHMKCAVICERGFILQASSGQRLRPMQKEILLTCSSGLW
DQAVSCAPLDCGIPDQSHVSYASFSCLEGTAFLKRCSFSCISPAKPQGMNQWLTCLEDGL
WSLPEAYCKLECDVPPVIPNANLLLPRCLQGNHDVGSVCRYQCEPGYYVAESKESKPRKV
LLKIQCLESGKWEPGSCVPVVCEPPAPVFEGMYTCTSGFKLGSQCVLNCNLASQRXXXXX
XXEGLWTEEFKLCDLQGECPPRPELNLVEYKCEGYGIAMCTPSCIIPPSDPVILPENITT
DTVEHWMEPXXXXNIVCTGRLRWHPDPSLVHCIQSCEPFQADGWCDTINNRAYCQYDGGD
CCSSTLSSKKVIPFAADCEQDECTCRDPKAEENQ
Download sequence
Identical sequences ENSMEUP00000013019 ENSMEUP00000013019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]