SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013425 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013425
Domain Number 1 Region: 77-135
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000437
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 2 Region: 4-32
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000098
Family C-type lectin domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013425   Gene: ENSMEUG00000014705   Transcript: ENSMEUT00000014749
Sequence length 135
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4335:16003:25822:-1 gene:ENSMEUG00000014705 transcript:ENSMEUT00000014749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILLRPSCSPGWFYYRSNCYGYFRKRLSWSDAEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXNNNWKWIDGGLFLFRAWSDKSPHGNKACGEMAYQNNFLTWNK
NHCSKRQHFVCKYRP
Download sequence
Identical sequences ENSMEUP00000013425 ENSMEUP00000013425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]