SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013675 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013675
Domain Number 1 Region: 530-637
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-19
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 2 Region: 342-458
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000144
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 3 Region: 288-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000354
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 167-290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000101
Family Spermadhesin, CUB domain 0.0077
Further Details:      
 
Domain Number 5 Region: 642-700
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000144
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 703-766
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000031
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 770-838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000017
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 463-528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000122
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013675   Gene: ENSMEUG00000014980   Transcript: ENSMEUT00000015027
Sequence length 909
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_235:31414:45467:-1 gene:ENSMEUG00000014980 transcript:ENSMEUT00000015027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPGAGLLPPPLLLXXXXXXXXXXXXVPLKEEETLSGGSSESPTISPAALAELLHGALL
RRGPEMGDIPGSLLVPTLAADTEDQTLAPPSPPWVTEPGTGPLTTAVTPKGARQAGPTAP
ELLTPPPGTTAPPLPGPASPGPPLGSEGGEEETTTTLITTTTVTTVTSPVLCNNNVSEGE
GYVESPEFGRSAAPTLGPLDCTYSLSVYPGYGIEIQVQSLNLSQEEGLLVLAVGGAPAPA
PQLLANASLLGEGQVLRSPTNRLLLHFRSPRTPRGGGFRIHYQAYLLSCGFPPRPPHGDV
SVTDLHPGGTATFHCDSGYQLQGEDTLVCLNATRPAWSGEPPACLAACGGSIHNATLGRI
VSPEPGGAVGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLVVRSGGGPLSPLIYDSD
MDDVPERGLISDAQSLYVELLSETPANPLLLSLRYEAFEEDRCFAPFLAHGNVTSTDPQF
RPGALATFSCLPGYALEPPGPPSAIECIDSSDPHWNDTEPACKAMCGGELSESAGVVLSP
DWPQSYSPGQDCVWGLHVQEEKRILLQVEILNVRGGDMLTLFDGDSPSARVLAQLRGPQP
RRRLLSSGPDLTLQFQAPAGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGD
LIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEISNGHRTASDA
GFPIGSHIQYRCLPGYSLEGAAVLTCYNRDTGTPKWSDRVPKCVLKYEPCLNPGVPENGY
QTLYKHHYQAGESLRFFCYEGFELIGEVTITCLPGHPSQWTSQPPLCKVTQTTDPSRQME
GGNLALAILLPLGLVILLIGGVYLYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEAG
DTREYEVSI
Download sequence
Identical sequences ENSMEUP00000013675 ENSMEUP00000013675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]