SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014007 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014007
Domain Number 1 Region: 423-680
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.93e-72
Family Eukaryotic proteases 0.0000000601
Further Details:      
 
Domain Number 2 Region: 15-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-30
Family Spermadhesin, CUB domain 0.00000201
Further Details:      
 
Domain Number 3 Region: 172-286
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-23
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 
Domain Number 4 Region: 357-428
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000126
Family Complement control module/SCR domain 0.0000812
Further Details:      
 
Domain Number 5 Region: 303-360
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000639
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 125-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000061
Family EGF-type module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014007   Gene: ENSMEUG00000015343   Transcript: ENSMEUT00000015389
Sequence length 686
Comment pep:known_by_projection scaffold:Meug_1.0:Scaffold20512:6282:18894:1 gene:ENSMEUG00000015343 transcript:ENSMEUT00000015389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCVVLFAALAWAEETSMYGEILSPNYPQAYPNDAQKTWNIRVPDGYGIRLYFTHLDMELS
ANCEYDSVKIMSGDVVEGVLCGQKSSKNPGSPIVKEYHVPYNSLQVIFESDFSNEERFTG
FAAYYVAVDVNECTDFEDAPCSHFCNNYIGGYFCSCPPEYFLHDDMKNCGVNCSGNVFTD
PTGEITSPNYPSLYPENSRCDYRVFLEKGFQVVVTIKREDFDVEAGDADGDCPDKLLFTA
GGQQFGPYCGNGFPGQQIIETKDNVLDIIFQTDETGQKKGWKLRYYGDPMPCPKEFTAHS
VQDPVKATYVYKDTVKITCLEGFEVVEGKVSSTSFYSSCQSNGKWSNSNLKCKPVDCGSP
EPIKNGKADNTENTLFGAVIQYTCNEPYYSMKTEGTGEYRCAANGTWVNKVLGMELPECV
AVCGVPSQPFAGIQRIFGGRITDISSFPWQVFFQSPRAGGALIDEHWVLTAAHVLESNSN
PVMYMGSTTVNNAALEKGQMLLADGVFIHPDWTLLEGQTRKNFDNDIALVRLKDPVKLGP
NVSPICLPDSSPDYDLKFGTLGLISGWGRTNDRRIVVKLRGTSLPVAPLEKCQSVKSEDP
KTDINTFTFTNNMICAGGEKGSDSCEGDSGGAFAVQVPNEEKTKYYVAGLVSWGPRCGTY
GIYTRVKNYLSWIKKTMQENRISDQD
Download sequence
Identical sequences ENSMEUP00000014007 ENSMEUP00000014007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]