SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014407 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014407
Domain Number 1 Region: 337-459
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 113-215
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000785
Family DBL homology domain (DH-domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014407   Gene: ENSMEUG00000015780   Transcript: ENSMEUT00000015822
Sequence length 533
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_6977:3257:62111:-1 gene:ENSMEUG00000015780 transcript:ENSMEUT00000015822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKRQRQNNFSMFPSPKGWNFRGRKRKQSTQDEDAISLCSLDTNEPSNKRVKPLSRVTSLA
NLIPPVKATPLKRFSQTLQRSISFRSDSRPDILTPRPWSRNAAPASTKRRDSKLWSETFD
VCVNQMLTSKEIKRQEXXXXXXXXXXXXXXXXXXXXXAYHDPMLKLSIMTEQELNQIFGT
LDSLIPLHEDLLSQLQEVRKADGSTEHVGPILVGWXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XINIIQGIVAEINTKTGESECRYYKERLMYLEEGQKDSLIDSSRALCCHGELKNNRGVKL
HVFLFQEVLVITRPVTHNEQLCYQLYRQPIPVKDLLLDDLQDGEVRLGGSIRGAFTNNER
IKNFFRVSFRSGSQSQSHTLQASDTFNKQQWLNCIRQAKERAVCAEGRAGMLGPQESSPL
SAPLSGETKLEQMDQSGSESDCSMDTSEVSLDCERMEQTDSCGGNSKQIESNV
Download sequence
Identical sequences ENSMEUP00000014407 ENSMEUP00000014407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]