SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014423 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014423
Domain Number 1 Region: 375-596
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-51
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 615-686,797-835
Classification Level Classification E-value
Superfamily PH domain-like 0.00000816
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014423   Gene: ENSMEUG00000015783   Transcript: ENSMEUT00000015839
Sequence length 1344
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2018:3268:109825:1 gene:ENSMEUG00000015783 transcript:ENSMEUT00000015839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NELKSAANNDEEEEGEQFDFDSGDEIPEADRQALLPSSESDSKGDAENKEVPSTGESNEA
GGDNLQVAESGKLAVPMKVNPYSVINITPFQEKEQLSPDPSAEESSSSSMQSVYSVPVPC
GYAVPSNLPLILPAYSSPIIIRTLSVDEEXXXXXXXXXXXXXXXXXXXXXXXEDQVNKGD
SPLAKWVADLANTAWXXXPEEVIYDDVPRENSDSEPEEMIYDDVENGDEGGNSSLDYGWS
SSEFESYEEQSDSECKNGIPSSFLRGNHKKQLSHDLTRLKEHYEKKMKDLMANTVGAVEI
QQLKQKHELKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHRSCLQEEELN
LFIDVDCVHTEAIMTPMPEGLSQQQVVRRYILGSVVDSEKNYVDALKRILEQYEKPLSEM
EPKVLSERKLKMVFYRIKEILQCHSMFQIALASRXXXXRVSEWDSVEMIGDVFVASFSKS
MVLDAYSEYVNNFSTAVGILKKTCATKPAFLDFLKQCQESSPDRITLYGLMMKPIQRFPQ
FILLLQDMLKNTTKGHPDRLPLQMALTELETLAEKLNERKRDADQRCEIKQIAKAINERY
LNKLLSSGNRYLIRSDDMVETVYNDKGEIVKTKERRLFMLNDVLMCATVSARTSHESSGA
ISTSQRYLLKWSVPLGHVEVIEYSSGQGQGENSRYPPAHSTESIIVVANAKPHKLYMGPG
QLYHDLQNLLHDLNVVGQISQLIGNLKGNYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXQLPGKQDKSGRPTFFTAVFNTFTPAIKQSWINNLQMAKLALEEENHLGWFCVED
DGNQIKKEKHPLLVKHMPVMVAKQQEFKIECAAYNPEPYIGNETEPNSFSMQHGFLWIGQ
CTNQMGQIAIISFQHSSPKVIECFNVESRILCMVYIPVDQKHKESNVTPDSETMVGKASD
VPTICLGTEEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLTCTSQCLYAGLVNGNVAVY
AKTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHLEAHQE
EGMVISHMAVAGVGIWIAFTSGSTLRLFHTETLKHLQDINIATPIHHMLSXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSKG
HSRNSLLPNSEPQGDDQKDILPDEVSNSYLSQSTTDNAVWLGDSVGSITQKSDLSSSSGS
LTLSHGSSSLEHAPEDSTIYELLKDPNIALNKGKSHQFKKTKASSVLVICGGQGHRRVNK
KAKQQRQDELVSSVMVWQIPLLNI
Download sequence
Identical sequences ENSMEUP00000014423 ENSMEUP00000014423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]