SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014468 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014468
Domain Number 1 Region: 198-458
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-85
Family Eukaryotic proteases 0.0000000202
Further Details:      
 
Domain Number 2 Region: 111-210
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000107
Family Hepsin, N-terminal domain 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014468   Gene: ENSMEUG00000015838   Transcript: ENSMEUT00000015885
Sequence length 470
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2116:435:18485:1 gene:ENSMEUG00000015838 transcript:ENSMEUT00000015885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSRLSLLGSAPLSAGAGAGLGWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQVSPADLRLTVFD
GTEGTWRLLCSSRANSRVASLSCEEMGFIRSLTHSELDVRVFGTNGTSGYFCVDEERLPY
ARRLSEVISICDCPRGLFLATLCQDCGRRKLPVDRIVGGQDASLGRWPWQVSLRYDGSHL
CGGSLLSGDWVLTAAHCFPERNRVVSRWRVFAGAVAQASTQGLQLGVQAVVYHGGYLPFR
DPNSEENSNDIALVHLSSSLPLTEYIQPVCLPAAGQTLVDGKICTVTGWGNTQYYGKQAN
LLQEARVPIISNTVCNGPDFYGNQIKPKMFCAGYTEGGIDACQGDSGGPFVCEDSISRTA
RWRLCGIVSWGTGCALAHKPGVYTKVGEYQEWIYRAMKTHSEDSGMVTQL
Download sequence
Identical sequences ENSMEUP00000014468 ENSMEUP00000014468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]