SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014520 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014520
Domain Number 1 Region: 20-117
Classification Level Classification E-value
Superfamily Lysozyme-like 1.69e-27
Family C-type lysozyme 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014520   Gene: ENSMEUG00000015902   Transcript: ENSMEUT00000015941
Sequence length 118
Comment pep:novel scaffold:Meug_1.0:Scaffold23673:19736:22246:-1 gene:ENSMEUG00000015902 transcript:ENSMEUT00000015941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLLLLRFIFLTMAVHHRKMERCEFAKRLNQLHLDAYGDLVLVIWCLAETESNLNTTAT
HYNPGDESTGYGIFQINSHYWCDDGKTPNALNWCLLEDNLIEAVNCVKKTVDRQGFQA
Download sequence
Identical sequences ENSMEUP00000014520 ENSMEUP00000014520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]