SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014593 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014593
Domain Number 1 Region: 72-182
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-21
Family C-type lectin domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014593   Gene: ENSMEUG00000015978   Transcript: ENSMEUT00000016018
Sequence length 182
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_6187:169:1617:1 gene:ENSMEUG00000015978 transcript:ENSMEUT00000016018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGMLSILLGAMLLWGQGGFSRRVVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSETEQKLIESMLQNLTKPDTGISDGDFWIGLWRNGEGQTSGACPNLYK
WSDGSSSQYRNWYTDEPSCGSEACVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNFICKY
EP
Download sequence
Identical sequences ENSMEUP00000014593 ENSMEUP00000014593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]