SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014816 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014816
Domain Number 1 Region: 103-188
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.02e-16
Family DBL homology domain (DH-domain) 0.002
Further Details:      
 
Domain Number 2 Region: 280-355
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000215
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000014816
Domain Number - Region: 4-49
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00729
Family DBL homology domain (DH-domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014816   Gene: ENSMEUG00000016201   Transcript: ENSMEUT00000016248
Sequence length 376
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9205:385:33814:1 gene:ENSMEUG00000016201 transcript:ENSMEUT00000016248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFMNTLKYLQNYECLLDVDLWRLFANLEELSQVSLGFLSCFFSTIKDYINSSGSASTMDF
ISVLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWCERHDQCKRLHLSEL
LVTPLHRLTRYPLLLKNIWRRSTDAREKITIYSLKEKVEKAICDLEGKVKWLDNFQKFRH
LQEIIVWPPLWDRDKRFFIPECLKHIFKEHMAENILSPGNRHLLHEGKLTLAXXXXXXXX
XXXXXXXXXXXXXXXXXXXKLGGSDTGLLCPSLTPELQAMIKEGGSCTVLDQPIPLDRLV
VKNIDPFHVSVFGLRNAFLLQHENSYQQCIAAFLLQAQTETAKKTWMVQIRMASSCFMKR
YETKKSFTSPAESSEI
Download sequence
Identical sequences ENSMEUP00000014816 ENSMEUP00000014816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]