SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014822 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014822
Domain Number 1 Region: 63-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-32
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 2 Region: 755-864
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-29
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 3 Region: 1804-1907
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.19e-27
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 4 Region: 410-519
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 5 Region: 2397-2465
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.22e-18
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 6 Region: 2214-2283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 2513-2580
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.94e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 8 Region: 2454-2524
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 9 Region: 2573-2642
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.36e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 10 Region: 2631-2700
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 11 Region: 1278-1386
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000262
Family Spermadhesin, CUB domain 0.0055
Further Details:      
 
Domain Number 12 Region: 281-346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000877
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 13 Region: 2266-2333
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000403
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 14 Region: 869-928
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000702
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 15 Region: 7-71
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000917
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 16 Region: 177-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 17 Region: 583-637
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000103
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 18 Region: 525-587
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000337
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 19 Region: 1452-1489
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000051
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 20 Region: 352-405
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000528
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 21 Region: 1048-1102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000085
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 22 Region: 1735-1799
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000135
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 23 Region: 1909-1970
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000229
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 24 Region: 2048-2097
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000208
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 25 Region: 2760-2810
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000417
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 26 Region: 712-763
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000792
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 27 Region: 1648-1681
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000085
Family Spermadhesin, CUB domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000014822
Domain Number - Region: 2128-2155
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00025
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Domain Number - Region: 2195-2219
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00116
Family Complement control module/SCR domain 0.0071
Further Details:      
 
Domain Number - Region: 2368-2390
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.005
Family Complement control module/SCR domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014822   Gene: ENSMEUG00000016165   Transcript: ENSMEUT00000016255
Sequence length 3042
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_8794:16347:235778:-1 gene:ENSMEUG00000016165 transcript:ENSMEUT00000016255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIDKGGCGDPGIPSYEKRTGNSFFHGDTLTFECQAAFELVGERVITCQQNNQWSGNKPSC
VFSCFFNFTTPSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAV
KDDGMSDVSVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDP
GIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCIMQDGNVVWSSTVPRCEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQTEVNYDTLEVRDGPAN
SSPLIGEYHGTQAPQFLISTGNYMYLLFTTDNSRSSVGFLIHYESVTLESDSCLDPGIPV
NGHRHGNNFGIRSTVTFSCDPGYTLSDEEPLVCERNHQWNHALPSXXXLCGGYIHGKSGT
ILSPGFPDFYPNSLNCTWTIEVSHGKGVQMIFHTFHLESSHDYLLITEDGSFTEPVARLT
GSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRRIGFH
FGVGDSLTFSCFPGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVTGNEGTLLSPNF
PSNYDNNHECIYKIETEAGKGIHLRARSFQLHEGDVLKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRIRDEGHFTDTIV
QYSCNPGYAMHGSSTMCLSGDRRVWDKPLHSCIAECGGRIHAATSGRILSPGYPAPYDNN
LHCTWIIEADPGKTISLHFIVFDTEMAHDILKVWDGPIDSNIFLKEWSGSALPEDIHSTF
NSLTLQFDSDFFISKSGFSIQFSTSIASTCNDPGMPQNGTRYGDSREPGDTITFQCDPGY
QLQGQAKITCVQLNNRFFWQPDPPTCIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXNIMNGTRIGTDFKLGSTVTYQCDSGYKIVDPSS
ITCVIGVDGKPAWNRVLPSCNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVFGQFAYFQTALNDLAELFDGAHPQARLLSSLSGFHSXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXPCSGNFTQRRGTILSPGYEPYGNNLNCIWKIIVTEGSGIQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTVPALLNSTSNQLYLHFQSDISVAAAG
FHLEYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRSHISCMPGTVRR
WNYPSPLCIAKCGGTLNSMTGVILSPGFPGAYPNNLDCTWKISLPIGYXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXYPILKDCIWLITVPQGHGVYINFTLLQTEAVNDYIAV
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQLKKCQSPP
AVPQAEILTEDNDFEIGDFVKYQCLPGFTLSGTDILTCKLSAQLQFEGSPPTCEAQCPAN
EVRTESSGVILSPGYPGNYFNSQTCSWTIKVEVGYNITIFVETFQSEKQFDVLEIFDGSS
GQSPLLVILSGNHTEQSNYTSKSHQLYFRWSTDHATSKKGFKIRYSAPYCSLTQTLKNGG
IVNRTRGPVGSRVHYFCKPGHRMIGHSNATCRRNSNGMYQWDSLTPLCQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT
QLSEHVIWRLVSGSVNEYGAQVVLSCSPGYYLNGQRLIQCQSNGTWSVGDERPSCKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXGYTLVGSHVRECLANGLWSGTETRCLXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRICLQDHKWSGQTPVCVPITCGHPG
NPAHGLTNGSEFNLNDVVNFTCSTGYLLQGAARAQCRSNGQWSSPLPTCRVVNCSDPGFV
ENAIRHGQQNYPESFKYGISVMYHCKKGFYLLGSSALTCKANGLWDRSLPKCLXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXLIGNATRVCQEDSHWSGTLPHCSGNNPGFCDD
PGTPAHGSRLGEEFKVKSLLRFSCEMGYQLRGSPERTCLLNGSWSGVQPVCEAVSCGNPG
TPANGMILNSDGILFSSSVIYACWEGYKTSGLTTRHCTANGTWTGTAPDCTVISCGDPGT
LANGIQFGNDFTFNKTVSYQCNPGYLMEPASASTIRCTKESTWNQSKPVCKAVMCGQPPQ
VQYGKVEGTDYRWGASISYSCAEGYQLSNSAILSCEGRGVWRGDVPQCLPVFCGDPGTPA
EGWISGKSFIYRSEVSFHCKSPFILIGSSRRICQADGTWSGIQPTCIDPAHNTCTDPGTP
HFGMQNSSRGYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
HADVRAIDLPTFGYTYVYTCHPGFFLAGGSEHRTCKPDMKWTGKSPVCKXXXXXXXXXXX
XXXXXPSDVFFINSVWKGYYEYLGKRHPATLTVDWFNATSSKVNATFIEGSNVELKLSGV
YKKEEAHLLLKVFQIKGPVEIFVSKFENDNWGLDGYXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPLSIDPDSSNHYYGTNSSSVAAAILVPFFALILSGFAFYLYKHRTRPKVQYNGY
AGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences ENSMEUP00000014822 ENSMEUP00000014822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]