SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014966 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014966
Domain Number 1 Region: 229-406
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-33
Family DBL homology domain (DH-domain) 0.00089
Further Details:      
 
Domain Number 2 Region: 389-502
Classification Level Classification E-value
Superfamily PH domain-like 6.94e-25
Family Pleckstrin-homology domain (PH domain) 0.0023
Further Details:      
 
Domain Number 3 Region: 641-735
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-22
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 4 Region: 545-583
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000293
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014966   Gene: ENSMEUG00000016362   Transcript: ENSMEUT00000016410
Sequence length 762
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4960:8459:63650:1 gene:ENSMEUG00000016362 transcript:ENSMEUT00000016410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVKPVPAFISKEKPSKVSDLISHFEGGGTSSNSTDLKKESSRAQGRHGLTTVLXXXQS
KLVSQHPLQKQETETDQTQDVQKHTANGVIGAQKQMECEDDKFPTVIPDVCNQTWEPAIY
SNLAIGEKDRIATSSSLPKTNIFRGSTVNSCHRTSSNNPLLLVEEEHVEMKASLEEKKDE
ESPLEQLEKQNQHETKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFYCKLLEEANRGS
FPAEMVNKIFSNISSINAFHSKFLLPELEKRMQEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXAMELVKTMTDRMPQFKAVIEEIQKQEICGNLTLQHHMLEPVQRIPRYEMLLKDYLR
KLPPDSLDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEVYEMLGEEEDIVNPSNELI
REGQILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKYSVRTRVGIDGMKIVETHNE
EYPHTFQISGKERTLELQAXXXXXXXXXXXALQNTIEAFHQRHETFRNAIAKDNDMHLEV
STAELGKRAPRWIRDNEVTMCMKCKESFNALTRRRHHCRACGHXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIESAEVSGNSVICSFLQYMEKSKPWQKAWC
VIPKQEALVLYMYGAPQDVRAQATIPLLGYTVDDTPRSADLPHSFKLTQSKSVHSFSADS
EELKQKWLKIIHLAVKGETPEYANELQVTENDHPGLKGKPEC
Download sequence
Identical sequences ENSMEUP00000014966 ENSMEUP00000014966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]