SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000015026 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000015026
Domain Number 1 Region: 747-895
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.11e-35
Family DBL homology domain (DH-domain) 0.000000106
Further Details:      
 
Domain Number 2 Region: 350-464
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.59e-19
Family Regulator of G-protein signaling, RGS 0.00081
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000015026
Domain Number - Region: 935-976
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000106
Family DBL homology domain (DH-domain) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000015026   Gene: ENSMEUG00000016413   Transcript: ENSMEUT00000016476
Sequence length 1520
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9823:672:44110:1 gene:ENSMEUG00000016413 transcript:ENSMEUT00000016476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HASILTRESPTDKKQKVERSTSHDFDPTDSSSKKTKSSSEESRSETYXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGAAMRAGVQTGDRIIKXXXXXXXXXXXXXXXXXXXXGSY
VALTVQGRPPGSPQIPLSDSEVDQTAFGHMSPIMTSPHSPGTSGNMEIITSSVLMGXXXX
XXXXXXXXXXXXXXXXXXXXXXLCQEDSRTPAQRLLKEIQEAKKHIPQLQEQLSKATGST
QDGSVVISSKTSGDSLLLSEVEXXXXXXXXXXXXXXXXXXXXXXXXXXSPRGGLKERIYL
EESPEKSEMIPDNDTQSNIGSPLIRTAPQIIGAEDDDFGTEHEQINGQCSCFQSIELLRS
RPAHLAVFLHHVVSQFDPATLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLKVSV
PEEISQDLEKRRPELIPEDLHRHYVQTMQDKVYPEVQKHLEDFXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTAQAVEEDKSSTMQYVILMYMKHLGVRVK
EPRNLEHKRGRIGFLPKIKQSIKKDREGEEKVKRRGFPSILGPPRRPSRHDNSAIGRAME
LQKQRHPKHLSTPSSVSPEPQDSAKLRQSGISSDVADTMYVPANPMSSLTSGISASQEGG
KENEIGSKQIGETPTSGDSTDGTPRTPNTVFDFPAPPLDQLQEEEGEVERLPEHGTPKSF
RKLDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLGLKPCEIKRQEVINELFYTER
AHVRTLKVLDQVFYQRVSREGILSSSELRRIFSNLEEILQLHIGLNEQMKAVRKRNDTSV
IDEIGEDLLIWFSGAGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPTEREKVKKAADHCRQILNYVNQAVKE
AENKQRLEDYQRRLDTSNLKLSEYPNVEELRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLLKQLLVQQLGLTEKRTHEDWQH
FLRFRTASQGVQVESPGAIQSVLDHSENNKTGQPGEGQMPLQIRTGEIAACYSPRTSVES
PVPQDYMELASQDSRASNVLVMDHMIMTPELSSTELEGGADDSGEHFFDAREAHSDDNPS
ESDGTERKEEEALQLRIXXNVLILDGFETVQESSTEEEVASGLPSVGWAHQQQPLRDPQS
DGGVSPFIPDFLVQQHWGPGEESGFSAQSPSSSSDSHSQIMQYIRKIEADLEHLKKVEES
YMTLQRLAGSALTEEHSDKS
Download sequence
Identical sequences ENSMEUP00000015026 ENSMEUP00000015026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]