SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000015262 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000015262
Domain Number 1 Region: 349-424
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000262
Family Mannose 6-phosphate receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily EF-hand 0.0000207
Family Polcalcin 0.071
Further Details:      
 
Domain Number 3 Region: 67-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000687
Family LDL receptor-like module 0.0048
Further Details:      
 
Domain Number 4 Region: 30-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000838
Family LDL receptor-like module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000015262   Gene: ENSMEUG00000016696   Transcript: ENSMEUT00000016750
Sequence length 425
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9610:7948:22897:1 gene:ENSMEUG00000016696 transcript:ENSMEUT00000016750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPPLLLPKRCAVEVKRPRGVSLTNHHFYDKSKPFTCLDGSSTIPFDQVNDDYCDCPDG
SDEPGTAACPEGRFHCTNAGYKPHYIPSSRVNDGICDCCDATDEYNSGVICENTCREMGR
KEKETLEQMAEVAREGFRLKKILIEEGKKGQEEKRSRLLSLQESKKALEEQVAMLRAVKE
EAEKPEKEFKERHHRLWEEQQAAARAARDQEQAASAFQELDDNTDGVISVAELQTHPELD
PDGDGALSEAEAQALLGETLQVDAASFRDSLWAAIKDKYQQEGALPPQPGKVDEEVEKDK
MPPYDEKTQAYIDAAQEARDHFEEAEKSLTEMEESIRNLEQEMALDLGPSGEFSYLFGQC
YELSTNEYIYRLCPFNRVTQKPNHGGSETNLGTWGSWDASEEEKFRIMHYEHGTGCWQGP
NRSTK
Download sequence
Identical sequences ENSMEUP00000015262 ENSMEUP00000015262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]