SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000015266 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000015266
Domain Number 1 Region: 353-599
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 8.9e-88
Family Mammalian PLC 0.00000044
Further Details:      
 
Domain Number 2 Region: 43-152
Classification Level Classification E-value
Superfamily PH domain-like 4.4e-25
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 654-728
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000187
Family PLC-like (P variant) 0.00055
Further Details:      
 
Domain Number 4 Region: 165-212
Classification Level Classification E-value
Superfamily EF-hand 0.00000123
Family EF-hand modules in multidomain proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000015266   Gene: ENSMEUG00000016697   Transcript: ENSMEUT00000016754
Sequence length 731
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_8672:219:28122:-1 gene:ENSMEUG00000016697 transcript:ENSMEUT00000016754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCPWWKRRSGGEGACVPDPGSNGGSKGAALRALKKMDLNEDEDVLAMLKGSQFFKIRSL
KWQKVRFYRLQEDCMTVWFQRRFRHPKSHHVFSLQHIEAVRHGHQSEGLRRFGGAFPSSC
CLTITFKGRRKNLDLAAPTEEEAQRWVRGLAKLRARLNAMSQREKLDPWIHGYLHQADSD
HDSKMSFKEIKHLLQMVNVTMDDMYAHQLFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAFAQGC
RCVELDCWEGPDGEPVVYHGHTFTSKILFRDVIQVVRDHAFSLSPYPVILSLENHCGIQQ
QSTMARYLRTILQLKGRVLVKGNKLNQKEETQSDLPEEDKENIKKRSQISSRLSDLVVYC
CASQLNLYLGSNQPCWVPSLNERKARKFIKEAGNNFVRHNTCQLCRVYPLGLRMTSANYN
PQEMWNGGCQLVALNFQTPGYEMDLNNGRFLVNGKCGYVLKPDFLRQRDTAFDPEHPGPH
QTTLIIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNLYWGQ
TLQFTLGVPELALVRFVVEDYDITSFNDFVGQFTLPMYSLKQGYRHIHLFSKDGASLSPA
TLFVHIQIKNQ
Download sequence
Identical sequences ENSMEUP00000015266 ENSMEUP00000015266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]