SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000989 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000989
Domain Number 1 Region: 182-305
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 6.67e-61
Family Dystroglycan, domain 2 0.000000475
Further Details:      
 
Domain Number 2 Region: 497-598
Classification Level Classification E-value
Superfamily Cadherin-like 7.38e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 63-160
Classification Level Classification E-value
Superfamily Cadherin-like 1.73e-16
Family Dystroglycan, N-terminal domain 0.00000846
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000989   Gene: ENSMEUG00000001076   Transcript: ENSMEUT00000001075
Sequence length 895
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_8157:20629:46785:1 gene:ENSMEUG00000001076 transcript:ENSMEUT00000001075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMTVGFVLLPPLWGRTFFILLMIASAQSHWPSEPSEVVRDWENQLEASMHSVLSDLRET
IPAVVGIPDGIAVVGRSFRLAIPTDLIASNGEIIKMSEAGKEVLPSWLHWDPESRMLEGL
PLDTDKGVHYISVNAMHLAPNGSYVPQAMNVFSIEVYPEDHSEPQSVRVAPQDVNEAAAF
VCGADEPVTILTVILDADLTKMTPKQRIELLSRMKSFSELELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPNISSVETPAKEGTMSAQLGYPVVGWHIA
NKKPHFPKRIRRQINATPTPVTAIGPPTTALQEPPSRIVPTPTSPAIAPPTETAAPPVRD
PVPGKPAVTIRTRGAIVQTPTLGPIQPTRVSDAGTTVPGQIRPTTVPGYIEPTAVVTPPT
TTTKKPRITTLKPATPSTTDSSTATTRRPTKKPRTSRPVPRVTTKAPLTRLETASPPART
RTTTSGTTRGSEPNKPPSLKNHIDRVDAWVGTYFEVKIPLDTFYDEEDTTTDKLKLTLKL
REQQMVGEKSWVQFNSNSQLMYGLPDSSHLGKHEYFMHATDKGGLSAVDAFEIHVHKRPQ
GDKSPAKFKATFRGDPASVVNDIHKKIMLVKKLALAFGDRNSSIITLQNITKGSIVVEWT
NNTLPLDPCPKEQIRGLSRRISEDDGKPRPVFSNTLEPEFKAVAISVMGSGSCKHVQFIP
VTADRRMPSEAPPTVVTEKDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTIEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQNMPETT
PLNQDTIGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences ENSMEUP00000000989 ENSMEUP00000000989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]