SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002708 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002708
Domain Number 1 Region: 296-422
Classification Level Classification E-value
Superfamily Nudix 7.31e-30
Family NADH pyrophosphatase 0.002
Further Details:      
 
Domain Number 2 Region: 16-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-19
Family Ankyrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002708   Gene: ENSMEUG00000002967   Transcript: ENSMEUT00000002975
Sequence length 430
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2734:14959:27144:-1 gene:ENSMEUG00000002967 transcript:ENSMEUT00000002975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATFKRNVRQELISQFHSLAAEGNISKLPIFLNQYPFLINETSENGWTALMYAARNGHPH
VVQFLLEKGCDRSIVNRSNQTALDIAKFWGYKHVATLLSNAMGIQKQFFLLNKMEEYENY
FSKTLLDRKSEKRTNLTWLSIKQNHPDTVYILFSDLSPLVTLTGQQPEVRLCRLNYTQIK
DYLTNLDNIILVFLGVELGIKKELINSSIGEDSNKEGDDGLVAWFAXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLVAIQAKPVFTHSYQFCLTYNSTTKIEGGFRVYLKEI
YFRLLSIHNTSYPRIDPVVIMQVLHPDGNKCLLGRQKRFPPGMFTCLAGFVEPGETIEDA
VRREVEEESGVKVGSVQYVSCQPWPMPSSLMIGCLAVAMSTEIKVDNEIDDARXXXXXXV
MDVLTKGNQQ
Download sequence
Identical sequences ENSMEUP00000002708 ENSMEUP00000002708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]