SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002772 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002772
Domain Number 1 Region: 166-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000135
Family I set domains 0.039
Further Details:      
 
Domain Number 2 Region: 2-49
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000511
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002772   Gene: ENSMEUG00000003038   Transcript: ENSMEUT00000003046
Sequence length 225
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1226:25:1716:1 gene:ENSMEUG00000003038 transcript:ENSMEUT00000003046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPGYTGREVLYENASLLIKNVQVTDGRNYTFQEIRPNLSTATTYKQLQVYXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXGPDTPMIVPIDSNYPVGAALSSCCADSYPFAQYTWL
FNGFRSIPQLTLPDVSLNDTGTYTCNASNSVPGLSSSKDINVTIY
Download sequence
Identical sequences ENSMEUP00000002772 ENSMEUP00000002772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]