SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003861 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003861
Domain Number 1 Region: 691-748
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 2-43
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000602
Family Somatomedin B domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003861   Gene: ENSMEUG00000004229   Transcript: ENSMEUT00000004249
Sequence length 782
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1509:3613:17299:1 gene:ENSMEUG00000004229 transcript:ENSMEUT00000004249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALESCAGHCGDFRGNCSCHVTCPSLNTCCSDYHKFCLKISPYSGSIMGGKDFVVLNMGLP
SLRDLILCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
HPSKVSDSDKSELINDTMWQNYGTPGVAGNLTLSWKSSQLPESRVNIELWGYQETGKPYS
DEWKAEWSYLYTLARNISNRNTFTFTPMPAKAQYQKWEVGALRISGSSHTDGKRDVPAIW
SSEHALSWHFGEDFRRDSAAWATAKCLKWVELENKLPNFLAELVDCPCTLAQARADTGRY
FTDYGCDIEKKNSCTYHPEAVHCVRSIQGSPLYASGQQCCYTASGTQLLTKDSTSGSTPD
RGHDWGVYPYGHPPRVPGLSHWLYDVISYYYCCLWSQNCKFYVDLRPSSDCRTYSPPHLA
SAFGDPHFLTFDGVHFTFNGRGEYVLVQSDLTKLMVQGRTQPPLMSSGTQVLATGISAVV
VKENTSDVLEVRLGIMAGLEVLLNQEMLNFTEQTWLDLKGMFLSVSGSQSVSVMLDSGTG
VEIKAQEHFLSVNVLLPDKFINRTQGLLGTLNNISSDDFTLRNKTVLSPQITSDPHKLFE
FGADWAIWNDSSLFTYDSQSLVDNYLLRPKHDPTFLPVFSPGADTPSANLCGTNLFCQFD
ALVTGRLDIGNATRVASEQHKHLQQNLQPVVSCGWLSAPDHGKKNGTRYLVGSTIKFSCL
PGYKLRGSKEQTCQPDGQWSGVRPQCKKDRRYTVLLGIIFGVLLAVAVAVLGYVMLKRRR
RR
Download sequence
Identical sequences ENSMEUP00000003861 ENSMEUP00000003861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]