SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004002 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004002
Domain Number 1 Region: 285-348
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 9.29e-25
Family Small-conductance potassium channel 0.00025
Further Details:      
 
Domain Number 2 Region: 187-329
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.84e-24
Family Voltage-gated potassium channels 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004002   Gene: ENSMEUG00000004392   Transcript: ENSMEUT00000004405
Sequence length 424
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2026:624:8030:-1 gene:ENSMEUG00000004392 transcript:ENSMEUT00000004405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVPGLGALRRRKRLLEEEKSLAGWALAMAGVGIGMMVLHAEMLWFGQCQWIPYLFLVK
CGITISTLLLLGLILAFHAKEVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLYLVPRAVMLRSGVLLNASYRSI
GALNRVRFRHWFVAKLYMNTHPGRLLLALTLGLWLTTAWVLSVAERQAINATGHLTDTLW
LIPITFLTIGYGDVVPGTVWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFM
MDIQYAKEMRDSAARVLQEAWMFYKHSRRKESGASRRHQRKLLAAIHXXXXXXXXXXXXX
XXXXXXXXXXXMHMILCDLQSGLTTSHRDLEKRMDILGGKLDTLTQLLNAALEPGQPPEP
REAT
Download sequence
Identical sequences ENSMEUP00000004002 ENSMEUP00000004002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]