SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005211 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005211
Domain Number 1 Region: 21-148
Classification Level Classification E-value
Superfamily TPR-like 1.01e-16
Family Tetratricopeptide repeat (TPR) 0.0054
Further Details:      
 
Domain Number 2 Region: 823-859
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000816
Family HkH motif-containing C2H2 finger 0.07
Further Details:      
 
Domain Number 3 Region: 742-775
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000379
Family CCCH zinc finger 0.0059
Further Details:      
 
Domain Number 4 Region: 879-906
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000929
Family CCCH zinc finger 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000005211
Domain Number - Region: 478-506
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0659
Family CCCH zinc finger 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005211   Gene: ENSMEUG00000005691   Transcript: ENSMEUT00000005723
Sequence length 945
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_3487:763:32608:-1 gene:ENSMEUG00000005691 transcript:ENSMEUT00000005723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLPYRGTQEQYEVFLWTLIRHLFNEGNDIYQECDWSGSLSQYTEALNIADYARSEEIAI
SNEILEKLHINRIACYSNMGLNDKVLEDCDKVLSLNLNNCRALYRKAKALSDLGRYKEAY
DAIAKCSLAVPQDECVIKLTQELAQKLGFKIRKAYVRAKFSNSIPGEVTTKGSKSSVEDI
ELDLSDPKQEAAPIISLLPPDFAPELSNELAPIPITPLTPVLPLQMEKSPLPSAMLANGG
KISFTLPGTYLDDGDIVLGDEIDELLDSAPETDETILTATVVRGSIPTSSVTPSIPFSAP
LLGTCAGYVPASSFSEMYPQPLTSSLEDFCSSLNTFSMSDSKRDLPTSTSREGALLNNNN
SSILLMNGPASLFASESFLGIPSQPRNDFGNVFSSGSPKVSSSVAGRNPLEGTHELRQAC
QLCFIKSGPKLMDYTYLSTLDHKCKKDMLIGRIKNVEDKSWKKIRPRPTKTNYEGPYYIC
KDVAAEEECRYPGHCTFAYCQEEIDVWTLERKGAFSREALFGGSGKINFTVFRLLQEHHG
EFIFLCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVRYGCLREDECYYAHSLVELKVWIIQKETGITHDAIAQESKQYWQNME
AKAHGAQVPGNQIKYGSLNLKIKFVCAQCLRNGQVIEPDKNRKYCSAKAGHSWTKDRRAM
RVMSNERKKWMNIRPLPTKKQMPLQFDLCNHIASGKKCQYVGNCSFAHSPEEREVWTYMK
ENGIQDMEQFYDIWLKSQKPEKTDDVAGQSNKENGKQIHMPTDYAEITVDFHCWMCGKNC
NSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFSICDRYVAGTCTEGNNCKFAHG
NAELHEWQERRDVLKMKLSKARKDHLIAPNDNDFGKYSFLFKDLN
Download sequence
Identical sequences ENSMEUP00000005211 ENSMEUP00000005211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]