SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005242 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005242
Domain Number 1 Region: 597-642
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000956
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 2 Region: 674-706
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000402
Family Ovomucoid domain III-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005242   Gene: ENSMEUG00000005729   Transcript: ENSMEUT00000005757
Sequence length 932
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_3513:2334:45485:1 gene:ENSMEUG00000005729 transcript:ENSMEUT00000005757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALCCYHAKDNLMCRDVCEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFK
KSDGWVGLGCCELAIVLECRQACKQASSKNDISKVCRKEYEXXXXXXXXXXXXGSVCCSY
AGHHTNCREYCQAIFRTDSSPGPSQIKAVESYCASISPQLIHCVNNYTQSYPMRNPTDSL
YCCDRAEDYACQNACKRILMSMKTELEIVDGLIEGCKTMPLPQDPLWQCFLESSRSVHPG
VTVYPPPSTGLDGAKLHCCSKANTSTCRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVS
MLTCLADVREPCQLGCRNLSYCTNFNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPCN
CADQFVPVCGQNGRTYPSACIARCVGLQDHQFEFGSCVSKDPCNPNPCQKSQRCIPKPQV
CLTTFDKFGCNQYECVPRQLSCDQIRDPVCDTDNVEHNNLCTLYQRGKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTKKPITVLEILEKIRLHISVPQCDVF
GYLSIESEIVILIIPVDHYPKALQIEACNKEAEKIESLINSDSPTLSSHVPLSALVISRV
QVSSSLPSASTRTLPLYRPLFFTFCLLVLHGT
Download sequence
Identical sequences ENSMEUP00000005242 ENSMEUP00000005242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]