SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006367 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006367
Domain Number 1 Region: 32-121
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.51e-38
Family SCAN domain 0.0000659
Further Details:      
 
Domain Number 2 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 412-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-18
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 626-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 6 Region: 509-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000637
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 210-256
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000196
Family KRAB domain (Kruppel-associated box) 0.0035
Further Details:      
 
Domain Number 8 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000349
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006367   Gene: ENSMEUG00000006986   Transcript: ENSMEUT00000006998
Sequence length 680
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_98:472:7548:1 gene:ENSMEUG00000006986 transcript:ENSMEUT00000006998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGFSSQEQEGLLIVKLEEDCTWGQEISVQDHGTSPETSHQCFRHFRYHQATGPRQAFIQL
QELCHRWLRPEIHSKEQILELLVLEQFLTILPGDIQTRVREQHPESGEEAVTLVEELQRE
QARCRQQVTIHGRGQAVPLEETSPLEAAQEPPIFKLEPSETEQSPCLGLQDLLGPCPKGG
PQPLKERAPSTPWVSLLPSKAEGTEDKETAGSQLPVTFEDVAVYLSQEEWGHQEASKKVL
SREAIQENYENVVALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEKKE
NKEENSPSEHFDEEQPQEIPSGHSEIEVPWSPEQGKSEGQWNPSPEERLGKPIAWALGCS
ELIRPKKPQPGEKLYKCPVCEKNFSNNSNLIRHQRTHTTEKLCMGLECGEIFSGNPHFIP
PHRVHLGEEAHKCLECGKSFSQNTHLTRHQRTHTGEKPYQCNVCGKSFSCNSNLHRHQRT
HTGEKPYKCPECGEIFSHSSNLIRHQRIHTGERPYKCSECGKGFSRSSHLVIHERTHERE
RFYPFSECGGTVSNSTTFITNHGTQRGEKKLFKCLTCGKSFRQGMHLTRHQRIHTGEKPY
KCPLCGENFSHSSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYKCSQ
CGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences ENSMEUP00000006367 ENSMEUP00000006367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]