SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006456 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006456
Domain Number 1 Region: 773-954
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.72e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0026
Further Details:      
 
Domain Number 2 Region: 929-1043
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0051
Further Details:      
 
Domain Number 3 Region: 158-208,287-373
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-24
Family Phosphotyrosine-binding domain (PTB) 0.0077
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 7.11e-17
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006456   Gene: ENSMEUG00000007057   Transcript: ENSMEUT00000007090
Sequence length 1169
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_678:7595:149017:1 gene:ENSMEUG00000007057 transcript:ENSMEUT00000007090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTAKKYAFPSEISIDFSLQLVGSLPVHSLTTMPMLPWVVAEVRRLSMQSSKKEPV
VNQIRLCVSPACLKCEPDPGKSQQWDPLICSSIFEYKPQQVHKLIHNSHDPSYFACLIKE
VAASQQSICYVFKADDQTKVPEIISSIRQAGKIARQEEFHSQSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSCSRKAETCCPSPIRLPGSNVEQDRKPIRKSFSQPGL
RSLAFRKEFDAGHRSSSFFGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGQSEVY
LISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSENGGFHFVCYVFQCTNEALVD
EIMMTLKQAFTVAAVQQTSKVPVQQCEGCPMQCLHKLCERIEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXKIRPRNEQKENELVISFLRCLYEEKQKDHVHIGEGKQASQISAETIR
NELPTSATRFRLDMLKSKAKRSLTESLESILSRGSKARGLPENSGSVDLDSSISSTLSNT
SKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFESKTHHHDSNIESPLKTRRHSW
RQQIFLRVATPQKGCDSPGRYEDYSELGDLPPRSPLEPVCEDGPFGPVIEEKKRTSQELR
ELWKKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYDEITPCLKDVTSVWEKMLSTP
GRSKIKFDMEKIHSAVGQGVPRHHRGEIWKFLAEQYHLKHQFPSGKQQPKDIPYKELLKQ
LTSHQHSILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGVL
LLHMSEEDAFKXXXXXXXXXXXXKQYRPDMIILQIQMYQLSRLLHDYHRDLYSHLEEHEI
GPSLYAAPWFLTMFASQFPLGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQHENLE
TIVDFIKNTLPNLGLVQMEKTINQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVANGKIQNLEATIETLMANENKLKQRALALELERSALL
QTVEELQKKAAELGSGIPGLAKPELTEDW
Download sequence
Identical sequences ENSMEUP00000006456 ENSMEUP00000006456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]